PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_936250g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 325aa    MW: 36520.9 Da    PI: 7.7415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_936250g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181662248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+WT+eEd++l+d v+++G g+W++ ++  g+ R++k+c++rw +yl
   MA_936250g0010 16 GPWTPEEDQKLIDHVQRHGLGNWRSLPKLAGLSRCGKSCRLRWANYL 62
                     89*******************************************97 PP

2Myb_DNA-binding47.73.6e-1568111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++ +Ed+  ++++  lG++ W++Ia++++ gRt++++k++w++
   MA_936250g0010  68 RGTFSMQEDLTVIRLHSVLGNK-WSAIASHLP-GRTDNEIKNHWNT 111
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-24765IPR009057Homeodomain-like
PROSITE profilePS5129417.1971062IPR017930Myb domain
SuperFamilySSF466891.42E-3113109IPR009057Homeodomain-like
SMARTSM007172.2E-141464IPR001005SANT/Myb domain
PfamPF002497.1E-171662IPR001005SANT/Myb domain
CDDcd001672.83E-121762No hitNo description
PROSITE profilePS5129424.23163117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2466117IPR009057Homeodomain-like
SMARTSM007179.7E-1467115IPR001005SANT/Myb domain
PfamPF002495.3E-1468111IPR001005SANT/Myb domain
CDDcd001671.11E-970113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGRAPCCGDH EGLKSGPWTP EEDQKLIDHV QRHGLGNWRS LPKLAGLSRC GKSCRLRWAN  60
YLRPDIKRGT FSMQEDLTVI RLHSVLGNKW SAIASHLPGR TDNEIKNHWN TKLKKRLHLL  120
GIDPVTHMSL PTRDMLSSFM ASSSTAIAAR LNSALVEAQL ERLARDYVNI TRHVSSSSAD  180
QYSWQLSQIL NLVGTHNSPA WKHPSGPLSS ISTDQFLQPD ALRSLHGSQN QIYQGFVSGP  240
KDDSTEYNAF SQESLQFSDL EKKSEGKDLP IRTDHGNEYR TASSLIEDLP SAFDTEITDW  300
NSMPILMPSS NPDKNDHLYY SDKRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095853.15e-71Transcription factor
RefseqXP_011096186.18e-71PREDICTED: protein ODORANT1-like
RefseqXP_015886861.17e-71PREDICTED: protein ODORANT1-like
TrEMBLA0A151T7H69e-73A0A151T7H6_CAJCA; Transcription factor MYB39
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.13e-71myb domain protein 74